missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USF2 Polyclonal specifically detects USF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | USF2 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | BHLHB12, bHLHb12upstream stimulatory factor 2, Class B basic helix-loop-helix protein 12, FIPc-fos interacting protein, FOS-interacting protein, Major late transcription factor 2, Upstream transcription factor 2, upstream transcription factor 2, c-fos interacting |
| Gene Symbols | USF2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTI |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?