Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
952,097
results
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q14674 |
| Research Discipline | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Concentration | 0.9 mg/mL |
| Antigen | Separase |
| Gene Symbols | ESPL1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500 |
| Gene Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gene ID (Entrez) | 9700 |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | XJ11-1B12 |
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG2a |
| Gene Accession No. | P21796 |
| Research Discipline | Cellular Markers, Mitochondrial Markers |
| Concentration | 1 mg/mL |
| Antigen | VDAC1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence |
| Gene Alias | hVDAC1, MGC111064, Outer mitochondrial membrane protein porin 1, Plasmalemmal porin, PORIN, Porin 31HL, Porin 31HM, PORIN-31-HL, VDAC, VDAC-1, voltage-dependent anion channel 1, voltage-dependent anion-selective channel protein 1 |
| Gene ID (Entrez) | 7416 |
| Formulation | PBS (pH 7.4), 50% Glycerol |
| Immunogen | Fusion protein amino acids 1-283 (full-length) of human VDAC1. Mouse: 98% identity (279/283 amino acids identical). Rat: 98% identity (279/283 amino acids identical) >60% identity with VDAC2 and VDAC3. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S152B-23 |
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cell Biology, Cellular Markers, MAP Kinase Signaling, Neuroscience, Stem Cell Markers |
| Concentration | 1 mg/mL |
| Antigen | MAP2 |
| Regulatory Status | RUO |
| Purification Method | Immunogen affinity purified |
| Dilution | Western Blot 1:2000, Immunohistochemistry 1:1000-1:2000, Immunocytochemistry/ Immunofluorescence 1:1000-1:2000 |
| Gene Alias | DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2 |
| Gene ID (Entrez) | 4133 |
| Formulation | 50% PBS, 50% glycerol |
| Immunogen | MAP2 |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Novus Biologicals™ Human IgA ELISA Kit (Colorimetric)
CCL27 Colorimetric ELISA Kit useful in study of Cytokine
Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP (Pre-adsorbed), Novus Biologicals™
Goat Polyclonal Antibody has been used in 2 publications
Integrin alpha 6/CD49f Antibody (GoH3), Alexa Fluor™ 532, Novus Biologicals™
Rat Monoclonal Antibody
FABP1/L-FABP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Breast Cancer, Cancer, Cholesterol Metabolism, Diabetes Research, Lipid and Metabolism |
| Antigen | FABP1/L-FABP |
| Gene Symbols | FABP1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | FABPL, fatty acid binding protein 1, liver, fatty acid-binding protein, liver, L-FABPFatty acid-binding protein 1, Liver-type fatty acid-binding protein |
| Gene ID (Entrez) | 2168 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human FABP1/L-FABP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |