missing translation for 'onlineSavingsMsg'
Learn More

U11/U12-35K Antibody, Novus Biologicals™

Product Code. 18215033 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18215033 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18215033 Supplier Novus Biologicals Supplier No. NBP157499
 Restricted Item
Estimated Shipment: 14-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen U11/U12-35K
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5XKN9
Gene Alias HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog
Gene Symbols SNRNP35
Host Species Rabbit
Immunogen Synthetic peptides corresponding to U11/U12-35K The peptide sequence was selected from the N terminal of U11/U12-35K. Peptide sequence RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11066
Test Specificity Expected identity based on immunogen sequence: Human: 100%Mouse: 92%; Bovine: 92%; Zebra finch: 85%; Rat: 85%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.