missing translation for 'onlineSavingsMsg'
Learn More

sen15 Antibody, Novus Biologicals™

Product Code. 18448199 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18448199 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18448199 Supplier Novus Biologicals Supplier No. H00116461D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

sen15 Polyclonal antibody specifically detects sen15 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen sen15
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_443197.1
Gene Alias C1orf19, chromosome 1 open reading frame 19, hsSen15, sen15, SEN15 homolog, tRNA splicing endonuclease 15 homolog (S. cerevisiae), tRNA-intron endonuclease Sen15, tRNA-splicing endonuclease subunit Sen15
Host Species Rabbit
Immunogen C1orf19 (NP_443197.1, 1 a.a. - 171 a.a.) full-length human protein. MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 116461
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.