missing translation for 'onlineSavingsMsg'
Learn More

RBM14 Antibody, Novus Biologicals™

Product Code. 30228404 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30228404 100 μL 100µL
30230776 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30228404 Supplier Novus Biologicals Supplier No. NBP335319100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RBM14 Polyclonal antibody specifically detects RBM14 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen RBM14
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:100 - 1:500
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias COAAMGC31756, Paraspeckle protein 2, PSP2DKFZp779J0927, RNA binding motif protein 14, RNA-binding motif protein 14, RNA-binding protein 14, RRM-containing coactivator activator/modulator, SIPMGC15912, Synaptotagmin-interacting protein, SYT-interacting protein, SYTIP1, TMEM137, transmembrane protein 137
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).,, Sequence:, VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 10432
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.