missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18214962

PKLR Antibody, Novus Biologicals™

Product Code. 18214962 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18214962 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18214962 Supplier Novus Biologicals Supplier No. NBP156319
 Restricted Item
Estimated Shipment: 13-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PKLR Polyclonal specifically detects PKLR in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PKLR
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P30613-2
Gene Alias EC 2.7.1.40, PK1PKRL, PKL, PKR, Pyruvate kinase 1, pyruvate kinase isozyme R/L, pyruvate kinase isozymes R/L, pyruvate kinase type L, pyruvate kinase, liver and blood cell, pyruvate kinase, liver and RBC, Red cell/liver pyruvate kinase, RPK, R-type/L-type pyruvate kinase
Gene Symbols PKLR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PKLR(pyruvate kinase, liver and RBC) The peptide sequence was selected from the N terminal of PKLR (NP_870986). Peptide sequence STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE.
Molecular Weight of Antigen 58 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Chaperone Mediated Autophagy (CMA), Lipid and Metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5313
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.