missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEX11A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00 EUR
Specifications
| Antigen | PEX11A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PEX11A Polyclonal specifically detects PEX11A in Human samples. It is validated for Western Blot.Specifications
| PEX11A | |
| Polyclonal | |
| Rabbit | |
| O75192 | |
| 8800 | |
| Synthetic peptides corresponding to PEX11A(peroxisomal biogenesis factor 11A) The peptide sequence was selected from the middle region of PEX11A (NP_003838). Peptide sequence MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 28 kDa peroxisomal integral membrane protein, hsPEX11p, MGC119947, MGC138534, Peroxin-11A, peroxisomal biogenesis factor 11 alpha, Peroxisomal biogenesis factor 11Aperoxin-11A, peroxisomal membrane protein 11A, PEX11, PEX11-alpha, PMP28, Protein PEX11 homolog alpha | |
| PEX11A | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title