missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PEX11A Antibody, Novus Biologicals™

PEX11A Antibody, Novus Biologicals™

Product Code. 18238883 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18238883 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18238883 Supplier Novus Biologicals Supplier No. NBP159705

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PEX11A Polyclonal specifically detects PEX11A in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PEX11A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O75192
Gene Alias 28 kDa peroxisomal integral membrane protein, hsPEX11p, MGC119947, MGC138534, Peroxin-11A, peroxisomal biogenesis factor 11 alpha, Peroxisomal biogenesis factor 11Aperoxin-11A, peroxisomal membrane protein 11A, PEX11, PEX11-alpha, PMP28, Protein PEX11 homolog alpha
Gene Symbols PEX11A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PEX11A(peroxisomal biogenesis factor 11A) The peptide sequence was selected from the middle region of PEX11A (NP_003838). Peptide sequence MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8800
Test Specificity Porcine 77%, Bovine 79%, Canine 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by.
Target Species Human, Pig, Bovine, Canine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.