missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18214924

NUDT21 Antibody, Novus Biologicals™

Product Code. 18214924 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18214924 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18214924 Supplier Novus Biologicals Supplier No. NBP157540
 Restricted Item
Estimated Shipment: 06-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NUDT21 Polyclonal specifically detects NUDT21 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NUDT21
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O43809
Gene Alias CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit
Gene Symbols NUDT21
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NUDT21 (nudix (nucleoside diphosphate linked moiety X)-type motif 21) The peptide sequence was selected from the N terminal of NUDT21. Peptide sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 11051
Test Specificity This product is specific to Subunit or Isoform: 5.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.