missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18294512

MAK3 Antibody, Novus Biologicals™

Product Code. 18294512 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18294512 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18294512 Supplier Novus Biologicals Supplier No. NBP170631

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 2 publications

MAK3 Polyclonal specifically detects MAK3 in Human samples. It is validated for Western Blot, Immunohistochemistry.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MAK3
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q147X3
Gene Alias MAK3, MGC141884, N(alpha)-acetyltransferase 30, NatC catalytic subunit, N-acetyltransferase MAK3 homolog, N-alpha-acetyltransferase 30, NatC catalytic subunit, putative)
Gene Symbols NAA30
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NAT12(N-acetyltransferase 12) The peptide sequence was selected from the middle region of NAT12 (NP_001011713). Peptide sequence EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 122830
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 90%; Rat: 90%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.