missing translation for 'onlineSavingsMsg'
Learn More

LSM4 Antibody, Novus Biologicals™

Product Code. 18401001 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18401001 25 μL 25µL
18214788 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18401001 Supplier Novus Biologicals Supplier No. NBP18684625ul
  • ONLINE EXCLUSIVE PRICE
    415.00 EUR
    391.65 EUR / 25µL
    Save 23.35 EUR
    5% Off
 Restricted Item
Estimated Shipment: 12-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 1 publication

LSM4 Polyclonal specifically detects LSM4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LSM4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Glycine-rich protein, GRP, LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae), U6 snRNA-associated Sm-like protein LSm4, YER112W
Gene Symbols LSM4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 25804
Test Specificity Specificity of human LSM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.