missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IGF2BP1 Antibody, R&D Systems™

IGF2BP1 Antibody, R&D Systems™

Codice prodotto. 18620656 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
25 μL
0.1 mL
Dimensione della confezione:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity Dimensione della confezione
18620656 25 μL 25µL
18095186 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18620656 Fornitore Novus Biologicals N. del fornitore NBP23895625ul
 Restricted Item
Estimated Shipment: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

IGF2BP1 Polyclonal specifically detects IGF2BP1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigen IGF2BP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:10, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9NZI8
Gene Alias Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1
Gene Symbols IGF2BP1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10642
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.