missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GRB2 Antibody, Novus Biologicals™

GRB2 Antibody, Novus Biologicals™

Product Code. 18214545 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18214545 100 μL 100µL
18681387 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18214545 Supplier Novus Biologicals Supplier No. NBP255208
 Restricted Item
Estimated Shipment: 12-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GRB2 Polyclonal specifically detects GRB2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen GRB2
Applications Immunocytochemistry, Immunofluorescence, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2
Gene Symbols GRB2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Breast Cancer, Cancer, Extracellular Matrix, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2885
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.