missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Fc gamma RIIIA/CD16a Polyclonal antibody specifically detects Fc gamma RIIIA/CD16a in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Fc gamma RIIIA/CD16a |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Fc gamma RIIIA/CD16a (NP_000560.7). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?