missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Fc gamma RIIIA/CD16a Antibody - BSA Free, Novus Biologicals™

Fc gamma RIIIA/CD16a Antibody - BSA Free, Novus Biologicals™

Product Code. 18658200 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18658200 0.02 mL 0.02mL
18667220 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18658200 Supplier Novus Biologicals Supplier No. NBP2921940.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Fc gamma RIIIA/CD16a Polyclonal antibody specifically detects Fc gamma RIIIA/CD16a in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fc gamma RIIIA/CD16a
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Fc gamma RIIIA/CD16a (NP_000560.7). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 2214
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.