missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18215073

eEF1A1 Antibody, Novus Biologicals™

Product Code. 18215073 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18215073 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18215073 Supplier Novus Biologicals Supplier No. NBP152880
 Restricted Item
Estimated Shipment: 10-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

eEF1A1 Polyclonal specifically detects eEF1A1 in Human, Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen eEF1A1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P68104
Gene Alias CCS3, CCS-3, cervical cancer suppressor 3, CTCL tumor antigen, EE1A1, EEF-1, EEF1A, eEF1A-1, EF1AHNGC:16303, EF1a-like protein, EF-1-alpha-1, EF-Tu, elongation factor 1 alpha subunit, elongation factor 1-alpha 1, Elongation factor Tu, Eukaryotic elongation factor 1 A-1, eukaryotic translation elongation factor 1 alpha 1, eukaryotic translation elongation factor 1 alpha 1-like 14, FLJ25721, glucocorticoid receptor AF-1 specific elongation factor, GRAF-1EF, LENG7, leukocyte receptor cluster (LRC) member 7, Leukocyte receptor cluster member 7, MGC102687, MGC131894, MGC16224, prostate tumor-inducing protein 1, PTI1, translation elongation factor 1 alpha 1-like 14
Gene Symbols EEF1A1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK.
Molecular Weight of Antigen 50 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 1915
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.