missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DRG1 Antibody, Novus Biologicals™

DRG1 Antibody, Novus Biologicals™

Product Code. 18214902 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18214902 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Artikelnummer. 18214902 Lieferant Novus Biologicals Lieferanten-Nr. NBP155158
 Restricted Item
Estimated Shipment: 13-08-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

DRG1 Polyclonal specifically detects DRG1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen DRG1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias developmentally regulated GTP binding protein 1, developmentally regulated GTP-binding protein 1, developmentally-regulated GTP-binding protein 1, DKFZp434N1827, DRG-1, NEDD3, NEDD-3, Neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3
Gene Symbols DRG1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL.
Molecular Weight of Antigen 26 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4733
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.