missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DPPA2 Antibody, Novus Biologicals™

DPPA2 Antibody, Novus Biologicals™

Product Code. 18215013 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18215013 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18215013 Supplier Novus Biologicals Supplier No. NBP154631
 Restricted Item
Estimated Shipment: 06-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

DPPA2 Polyclonal specifically detects DPPA2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DPPA2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7Z7J5
Gene Alias CT100, developmental pluripotency associated 2, developmental pluripotency-associated protein 2, PESCRG1cancer/testis antigen 100, Pluripotent embryonic stem cell-related gene 1 protein
Gene Symbols DPPA2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DPPA2(developmental pluripotency associated 2) The peptide sequence was selected from the N terminal of DPPA2. Peptide sequence NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL.
Molecular Weight of Antigen 34 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Developmental Biology, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 151871
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.