missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18255234

R&D Systems™ DCPS Recombinant Protein Antigen

Produktkod. 18255234 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity Förpackningsstorlek
18255234 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18255234 Leverantör R&D Systems™ Leverantörsnummer NBP256249PEP
 Restricted Item
Estimated Shipment: 20-01-2027
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCPS. Source: E.coli Amino Acid Sequence: QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY The DCPS Recombinant Protein Antigen is derived from E. coli. The DCPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gene ID (Entrez) 28960
Product Line Novus
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name DCPS Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias DCS1, DCS-1, decapping enzyme, scavenger, EC 3.-, heat shock-like protein 1, HINT5, HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, HSL1, HSPC015, mRNA decapping enzyme
Gene Symbol DCPS
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52282. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only.

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.