missing translation for 'onlineSavingsMsg'
Learn More

CTDSP2 Antibody, Novus Biologicals™

Product Code. 18231084 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18231084 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18231084 Supplier Novus Biologicals Supplier No. NBP156566

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CTDSP2 Polyclonal specifically detects CTDSP2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CTDSP2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O14595
Gene Alias carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2, conserved gene amplified in osteosarcoma, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 2, NIF2, Nuclear LIM interactor-interacting factor 2, OS4NLI-interacting factor 2, Protein OS-4, PSR2, SCP2EC 3.1.3.16, Small CTD phosphatase 2, Small C-terminal domain phosphatase 2
Gene Symbols CTDSP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CTDSP2(CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2) The peptide sequence was selected from the middle region of CTDSP2. Peptide sequence ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 10106
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.