missing translation for 'onlineSavingsMsg'
Learn More

AKAP1 Antibody, Novus Biologicals™

Product Code. 18422271 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18422271 25 μL 25µL
18214798 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18422271 Supplier Novus Biologicals Supplier No. NBP18917225ul
  • ONLINE EXCLUSIVE PRICE
    415.00 EUR
    391.65 EUR / 25µL
    Save 23.35 EUR
    5% Off
 Restricted Item
Estimated Shipment: 13-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 1 publication

AKAP1 Polyclonal specifically detects AKAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AKAP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q92667
Gene Alias A kinase (PRKA) anchor protein 1, a kinase anchor protein 1, mitochondrial, AKAP121, AKAP149AKAP 149, AKAP84, A-kinase anchor protein 1, mitochondrial, A-kinase anchor protein 149 kDa, A-kinase anchor protein, 149kD, D-AKAP1, D-AKAP-1, Dual specificity A-kinase-anchoring protein 1, dual-specificity A-kinase anchoring protein 1, MGC1807, PRKA1, protein kinase A anchoring protein 1, protein kinase A1, Protein kinase A-anchoring protein 1, protein kinase anchoring protein 1, S-AKAP84, SAKAP84AKAP, Spermatid A-kinase anchor protein 84
Gene Symbols AKAP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8165
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.