missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AHSA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-14275-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
AHSA2 Polyclonal specifically detects AHSA2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| AHSA2 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Q719I0 | |
| AHSA2 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: DGNITGEYLGLLTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLT | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| activator of 90 kDa heat shock protein ATPase homolog 2, AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast), DKFZp564C236, FLJ34679, FLJ41715, Hch1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 130872 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido