missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Polyclonal specifically detects Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | h3-OST-3B, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1 |
| Gene Symbols | HS3ST3B1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSK |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?