missing translation for 'onlineSavingsMsg'
Learn More

ZC3H12C Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-16040-20UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331712

  • 168.46 EUR / 20µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ZC3H12C Polyclonal antibody specifically detects ZC3H12C in Human, Mouse samples. It is validated for Western Blot, Immunofluorescence
Specifications

Specifications

ZC3H12C
Polyclonal
Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
KIAA1726, MCP induced protein 3, MCP-induced protein 3, MCPIP3, probable ribonuclease ZC3H12C, zinc finger CCCH domain-containing protein 12C, zinc finger CCCH-type containing 12C
Recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1). KAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREKIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY
20 μg
Innate Immunity
85463
Store at -20°C. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunofluorescence
Unconjugated
PBS, 50% glycerol, pH7.3
Rabbit
Affinity purified
RUO
Primary
Human, Mouse
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers