missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ TRUB1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-80866PEP

Additional Details : Weight : 0.00970kg

Product Code. 18331621

  • 242.97 EUR / 0.10mL
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRUB1. Source: E.coli Amino Acid Sequence: TDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGG The TRUB1 Recombinant Protein Antigen is derived from E. coli. The TRUB1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-80866. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.



PBS and 1M Urea, pH 7.4.
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80866. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions



Special Offers

Special Offers

For Research Use Only