missing translation for 'onlineSavingsMsg'
Learn More

SV2A Antibody, Novus Biologicals™

Product Code. 18230582 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18230582 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18230582 Supplier Novus Biologicals Supplier No. NBP159666100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SV2A Polyclonal specifically detects SV2A in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SV2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7L0J3
Gene Alias KIAA0736SV2, synaptic vesicle glycoprotein 2A
Gene Symbols SV2A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT.
Molecular Weight of Antigen 83 kDa
Purification Method Affinity Purified
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 9900
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.