missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Splicing factor, arginine/serine-rich 11 Antibody, Novus Biologicals™

Splicing factor, arginine/serine-rich 11 Antibody, Novus Biologicals™

Product Code. 30227377 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227377 100 μL 100µL
30230316 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227377 Supplier Novus Biologicals Supplier No. NBP335832100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Splicing factor, arginine/serine-rich 11 Polyclonal antibody specifically detects Splicing factor, arginine/serine-rich 11 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Splicing factor, arginine/serine-rich 11
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 396-483 of human Splicing factor, arginine/serine-rich 11 (NP_001177916).,, Sequence:, SKKKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9295
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.