missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™

SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™

Product Code. 30227263 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227263 100 μL 100µL
30227563 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227263 Supplier Novus Biologicals Supplier No. NBP333387100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

SLC6A2/NET/Noradrenaline transporter Monoclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC6A2/NET/Noradrenaline transporter
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2/NET/Noradrenaline transporter.1).,, Sequence:, MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6530
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.