missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PRPSAP2 Antibody, Novus Biologicals™

PRPSAP2 Antibody, Novus Biologicals™

Product Code. 30228729 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30228729 100 μL 100µL
30227344 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30228729 Supplier Novus Biologicals Supplier No. NBP335590100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PRPSAP2 Polyclonal antibody specifically detects PRPSAP2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PRPSAP2
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias MGC117304, MGC126719, MGC126721, PAP4141 kDa phosphoribosypyrophosphate synthetase-associated protein, phosphoribosyl pyrophosphate synthase-associated protein 2, phosphoribosyl pyrophosphate synthetase-associated protein 2, PRPP synthase-associated protein 2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1).,, Sequence:, HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 5636
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.