missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pinin Antibody, Novus Biologicals™

Pinin Antibody, Novus Biologicals™

Product Code. 30227772 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227772 20 μL 20µL
30229412 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227772 Supplier Novus Biologicals Supplier No. NBP33570920ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Pinin Polyclonal antibody specifically detects Pinin in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pinin
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 140 kDa nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, DRS protein, DRSP, DRSSR-like protein, Melanoma metastasis clone A protein, MEMA, neutrophil protein, Nuclear protein SDK3, pinin, pinin, desmosome associated protein, SDK3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pinin (NP_002678.2).,, Sequence:, MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5411
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.