missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NDUFS6 Polyclonal antibody specifically detects NDUFS6 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | NDUFS6 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CI13KDA, Complex I-13kD-A, mitochondrial respiratory chain, 13-kD subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).,, Sequence:, GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?