missing translation for 'onlineSavingsMsg'
Learn More

MKK7/MEK7 Antibody, Novus Biologicals™

Product Code. 18264254 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18264254 100 μL 100µL
18649007 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18264254 Supplier Novus Biologicals Supplier No. NBP256278

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MKK7/MEK7 Polyclonal specifically detects MKK7/MEK7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MKK7/MEK7
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase kinase 7, MKK7MAPKK 7, PRKMK7
Gene Symbols MAP2K7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 5609
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.