missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
203.00 EUR - 484.00 EUR
Specifications
| Antigen | MAL2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18331295
|
Novus Biologicals
NBP3-10113-25UL |
25 μg |
203.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18330876
|
Novus Biologicals
NBP3-10113-100UL |
100 μg |
484.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MAL2 Polyclonal specifically detects MAL2 in Mouse samples. It is validated for Western Blot.Specifications
| MAL2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| MAL proteolipid protein 2, mal, T-cell differentiation protein 2 (gene/pseudogene), MAL2 proteolipid protein, protein MAL2 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of Mouse MAL2 (NP_849251.1). Peptide sequence MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 114569 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title