missing translation for 'onlineSavingsMsg'
Learn More

MAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10113-25UL

Additional Details : Weight : 0.00970kg

Product Code. 18331295

Estimated Shipment: 26-08-2024
to see stock.

Description

MAL2 Polyclonal specifically detects MAL2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	MAL2
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	MAL proteolipid protein 2, mal, T-cell differentiation protein 2 (gene/pseudogene), MAL2 proteolipid protein, protein MAL2
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of Mouse MAL2 (NP_849251.1). Peptide sequence MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Mouse
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	114569
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description