missing translation for 'onlineSavingsMsg'
Learn More

MAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10113-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331295

  • 191.14 EUR / 25µL
Estimated Shipment: 15-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

MAL2 Polyclonal specifically detects MAL2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

MAL2
Polyclonal
Western Blot 1.0 ug/ml
MAL proteolipid protein 2, mal, T-cell differentiation protein 2 (gene/pseudogene), MAL2 proteolipid protein, protein MAL2
The immunogen is a synthetic peptide directed towards the N terminal region of Mouse MAL2 (NP_849251.1). Peptide sequence MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW
25 μg
Primary
Mouse
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
114569
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers