missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LKB1/STK11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 EUR - 500.00 EUR
Specifications
| Antigen | LKB1/STK11 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18294465
|
Novus Biologicals
NBP2-56895 |
100 μL |
500.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623317
|
Novus Biologicals
NBP2-56895-25ul |
25 μL |
302.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LKB1/STK11 Polyclonal specifically detects LKB1/STK11 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| LKB1/STK11 | |
| Polyclonal | |
| Rabbit | |
| Hypoxia Signaling, mTOR Pathway, p53 Pathway, Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6794 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11.1, LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome), PJS, PJS polarization-related protein LKB1, Renal carcinoma antigen NY-REN-19, serine/threonine kinase 11, serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1, STK11 | |
| STK11 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title