missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LKB1/STK11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56895
This item is not returnable.
View return policy
Description
LKB1/STK11 Polyclonal specifically detects LKB1/STK11 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| LKB1/STK11 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| EC 2.7.11.1, LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome), PJS, PJS polarization-related protein LKB1, Renal carcinoma antigen NY-REN-19, serine/threonine kinase 11, serine/threonine-protein kinase 11, Serine/threonine-protein kinase LKB1, STK11 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| STK11 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR | |
| 100 μL | |
| Hypoxia Signaling, mTOR Pathway, p53 Pathway, Protein Kinase | |
| 6794 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction