missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PSMC2 (aa 84-166) Control Fragment Recombinant Protein

Código de producto. 30207244
Cambiar vista
Click to view available options
Quantity:
100 μL
Tamaño de la unidad:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
30207244 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30207244 Proveedor Invitrogen™ N.º de proveedor RP104876
 Restricted Item
Estimated Shipment: 14-08-2026
Añadir a la cesta
Añadir a la cesta
Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (∽31), barrel-shaped molecular machine with an apparent molecular weight of ∽2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman’s syndrome, and Liddle syndrome.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number P35998
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5701
Name Human PSMC2 (aa 84-166) Control Fragment
Quantity 100 μL
Gene Alias 26 S protease regulatory subunit 7; 26 S proteasome AAA-ATPase subunit RPT1; 26 S proteasome regulatory subunit 7; mammalian suppressor of sgv-1 of yeast; MGC3004; MSS1; Nbla10058; protease 26 S subunit 7; proteasome (prosome, macropain) 26 S subunit, ATPase 2; proteasome (prosome, macropain) 26 S subunit, ATPase, 2; proteasome 26 S subunit ATPase 2; proteasome 26 S subunit, ATPase 2; proteasome 26 S subunit, ATPase, 2; Protein MSS1; PSMC2; putative protein product of Nbla10058; S7; testis secretory sperm-binding protein Li 197 A
Common Name PSMC2
Gene Symbol PSMC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.