missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human METAP1 (aa 286-359) Control Fragment Recombinant Protein

Product Code. 30199547
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199547 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199547 Supplier Invitrogen™ Supplier No. RP102796

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58202 (PA5-58202. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number P53582
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23173
Name Human METAP1 (aa 286-359) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700029C17Rik; AW047992; DKFZp781C0419; EC 3.4.11.18; fc84e12; im:7047238; KIAA0094; KIAA0094MAP 1; MAP 1; MAP1; MAP1A; metAP 1; Metap1; metap1 protein; MetAP1A; Methionine aminopeptidase 1; methionyl aminopeptidase 1; mKIAA0094; Peptidase M; Peptidase M 1; Putative methionine aminopeptidase 1 (MetAP 1) (Peptidase M 1); wu:fc84e12; zgc:110093
Common Name METAP1
Gene Symbol METAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.