missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203057

Invitrogen™ Human CXXC5 (aa 191-261) Control Fragment Recombinant Protein

Product Code. 30203057
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203057 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203057 Supplier Invitrogen™ Supplier No. RP96938

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57694 (PA5-57694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CXXC5 is zinc finger protein closely related to the DVL1-binding protein CXXC4 (also known as Idax), and like CXXC4 is thought to modulate the Wnt signaling pathway during development. CXXC5 is upregulated in neural stem cells upon BMP4 stimulation, leading to decreased levels of the Wnt-signaling target AXIN2 and facilitated the response of the stem cells to Wnt3a. Recent reports suggest CXXC5 transcription is activated by the Wilms tumor 1 (WT1) transcription factor, and together are involved in the WNT/beta-catenin pathway and play a role in embryonic kidney development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7LFL8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51523
Name Human CXXC5 (aa 191-261) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930415K17Rik; CF5; CXXC finger 5; CXXC finger 5 protein; CXXC finger protein 5; Cxxc5; CXXC-type zinc finger protein 5; HSPC195; Putative MAPK-activating protein PM08; putative NF-kappa-B-activating protein 102; Retinoid-inducible nuclear factor; RINF; TCCCIA00297; WID; WT1-induced Inhibitor of Dishevelled
Common Name CXXC5
Gene Symbol CXXC5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.