missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BCL11A (aa 525-607) Control Fragment Recombinant Protein

Product Code. 30208217
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208217 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208217 Supplier Invitrogen™ Supplier No. RP109516

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H165
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 53335
Name Human BCL11A (aa 525-607) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810047E18Rik; B cell CLL/lymphoma 11 A; B cell CLL/lymphoma 11 A (zinc finger protein); BAF chromatin remodeling complex subunit BCL11A; B-cell CLL/lymphoma 11 A; B-cell CLL/lymphoma 11 A (zinc finger protein); B-cell CLL/lymphoma 11 A (zinc finger protein) isoform 2; B-cell lymphoma/leukemia 11 A; BCL11A; BCL-11 A; BCL11A B-cell CLL/lymphoma 11 A (zinc finger protein) isoform 1; BCL11A, BAF complex component; BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; C2H2-type zinc finger protein; COUP-TF interacting protein 1; COUP-TF-interacting protein 1; CTIP1; D930021L15Rik; ecotropic viral integration site 9 homolog; ecotropic viral integration site 9 protein; Ecotropic viral integration site 9 protein homolog; Evi9; EVI-9; Evi9a; Evi9b; Evi9c; FLJ10173; FLJ34997; HBFQTL5; Kiaa1809; mKIAA1809; myeloid leukemia; zinc finger protein 856; ZNF856
Common Name BCL11A
Gene Symbol BCL11A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.