missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc gamma RIIIA/CD16a Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
216.00 EUR
Specifications
| Antigen | Fc gamma RIIIA/CD16a |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18658200
|
Novus Biologicals
NBP2-92194-0.02ml |
0.02 mL |
216.00 EUR
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667220
|
Novus Biologicals
NBP2-92194-0.1ml |
0.1 mL |
N/A
|
N/A | |||||
Description
Fc gamma RIIIA/CD16a Polyclonal antibody specifically detects Fc gamma RIIIA/CD16a in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Fc gamma RIIIA/CD16a | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells | |
| PBS with 50% glycerol, pH7.3. | |
| 2214 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Fc gamma RIIIA/CD16a (NP_000560.7). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title