missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EIF2B2 Polyclonal antibody specifically detects EIF2B2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
Specifications
| Antigen | EIF2B2 |
| Applications | ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | EIF2B, eIF-2B GDP-GTP exchange factor subunit beta, EIF2BB, EIF-2Bbeta, eukaryotic translation initiation factor 2B, subunit 2 (beta, 39kD), eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa, S20I15, S20III15, translation initiation factor eIF-2B subunit beta |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human EIF2B2 (NP_055054.1).,, Sequence:, MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?