missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 EUR - 572.00 EUR
Specifications
| Antigen | DUSP23 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18220583
|
Novus Biologicals
NBP2-58763 |
100 μL |
572.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18642797
|
Novus Biologicals
NBP2-58763-25ul |
25 μL |
415.00 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DUSP23 Polyclonal specifically detects DUSP23 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DUSP23 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Protein Phosphatase | |
| dual specificity phosphatase 23, dual specificity protein phosphatase 23, DUSP25, EC 3.1.3.16, EC 3.1.3.48, FLJ20442, LDP3, LDP-3, Low molecular mass dual specificity phosphatase 3, low-molecular-mass dual-specificity phosphatase 3, MOSP, RP11-190A12.1, VH1-like member Z, VH1-like phosphatase Z, VHZ | |
| DUSP23 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 54935 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title