missing translation for 'onlineSavingsMsg'
Learn More

DUSP23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-58763-25ul

View more versions of this product

Product Code. 18642797

415.00 EUR / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DUSP23 Polyclonal specifically detects DUSP23 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	DUSP23
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gene Alias	dual specificity phosphatase 23, dual specificity protein phosphatase 23, DUSP25, EC 3.1.3.16, EC 3.1.3.48, FLJ20442, LDP3, LDP-3, Low molecular mass dual specificity phosphatase 3, low-molecular-mass dual-specificity phosphatase 3, MOSP, RP11-190A12.1, VH1-like member Z, VH1-like phosphatase Z, VHZ
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	DUSP23
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Quantity	25 μL
Research Discipline	GPCR, Protein Phosphatase
Gene ID (Entrez)	54935
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

DUSP23 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions