missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CROT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 EUR - 550.00 EUR
Specifications
| Antigen | CROT |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 1:50 - 1:200 |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229314
|
Novus Biologicals
NBP3-38113-100ul |
100 μL |
550.00 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228954
|
Novus Biologicals
NBP3-38113-20ul |
20 μL |
190.00 EUR
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CROT Polyclonal antibody specifically detects CROT in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western BlotSpecifications
| CROT | |
| ELISA, Immunoprecipitation, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| carnitine O-octanoyltransferase, COTperoxisomal carnitine O-octanoyltransferase, EC 2.3.1, EC 2.3.1.137, peroxisomal carnitine acyltransferase, peroxisomal carnitine octanoyltransferase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1).,, Sequence:, MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 54677 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title