missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CROT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38113-20ul
This item is not returnable.
View return policy
Description
CROT Polyclonal antibody specifically detects CROT in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Specifications
| CROT | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 1:50 - 1:200 | |
| carnitine O-octanoyltransferase, COTperoxisomal carnitine O-octanoyltransferase, EC 2.3.1, EC 2.3.1.137, peroxisomal carnitine acyltransferase, peroxisomal carnitine octanoyltransferase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1).,, Sequence:, MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunoprecipitation, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 54677 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction