missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CMTM6 Antibody, Novus Biologicals™

CMTM6 Antibody, Novus Biologicals™

Product Code. 30228811 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30228811 20 μL 20µL
30227979 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30228811 Supplier Novus Biologicals Supplier No. NBP33334120ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

CMTM6 Monoclonal antibody specifically detects CMTM6 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CMTM6
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias chemokine-like factor super family 6, chemokine-like factor superfamily 6, Chemokine-like factor superfamily member 6, CKLF-like MARVEL transmembrane domain containing 6, CKLF-like MARVEL transmembrane domain-containing protein 6, CKLFSF6, FLJ20396, PRO2219
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).,, Sequence:, LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 54918
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.