missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18242313

Novus Biologicals™ Carm1 Recombinant Protein Antigen

Produktkod. 18242313 Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18242313

Brand: Novus Biologicals™ NBP255993PEP

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carm1. Source: E.coli Amino Acid Sequence: HLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFI The Carm1 Recombinant Protein Antigen is derived from E. coli. The Carm1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gene ID (Entrez) 10498
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Carm1 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
Gene Symbol CARM1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51557. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only.

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.