missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18293465

ATP6V0A2 Antibody, Novus Biologicals™

Product Code. 18293465 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18293465 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18293465 Supplier Novus Biologicals Supplier No. NBP159069

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ATP6V0A2 Polyclonal antibody specifically detects ATP6V0A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP6V0A2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y487
Gene Alias A2, ARCL, ATP6a2, ATP6N1D, ATP6V0, ATPase, H+ transporting, lysosomal V0 subunit a isoform 2, ATPase, H+ transporting, lysosomal V0 subunit a2, infantile malignant osteopetrosis, J6B7, Lysosomal H(+)-transporting ATPase V0 subunit a2, regeneration and tolerance factor, RTF, STV1, TJ6A2V-ATPase, TJ6M, TJ6S, vacuolar proton translocating ATPase 116 kDa subunit a, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2, v-ATPase 116 kDa, V-ATPase 116 kDa isoform a2, Vph1, v-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 2, WSS
Gene Symbols ATP6V0A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATP6V0A2(ATPase, H+ transporting, lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23545
Test Specificity This product is specific to Subunit or Isoform: a isoform 2.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.