missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANO3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
496.00 EUR
Specifications
| Antigen | ANO3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ANO3 Polyclonal specifically detects ANO3 in Human samples. It is validated for Western Blot.Specifications
| ANO3 | |
| Polyclonal | |
| Rabbit | |
| anoctamin 3, anoctamin-3, C11orf25, GENX-3947, TMEM16C | |
| ANO3 | |
| IgG | |
| 115 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 63982 | |
| Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the C terminal of TMEM16C. Peptide sequence AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title