missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANO3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70410
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
ANO3 Polyclonal specifically detects ANO3 in Human samples. It is validated for Western Blot.
Specifica
| ANO3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ANO3 | |
| Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the C terminal of TMEM16C. Peptide sequence AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL. | |
| Affinity purified | |
| RUO | |
| 63982 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| anoctamin 3, anoctamin-3, C11orf25, GENX-3947, TMEM16C | |
| Rabbit | |
| 115 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto